Figure 2: Primary structure of microbial transglutaminase prepro-enzyme. Figure adapted from Kanaji et al. 1993;
Kashiwagi et al. 2002; Pasternack et al. 1998.
Antibody drug conjugate formation by MTG
An emerging field in oncology and beyond are antibody drug conjugates (ADCs). In ADC development, the aspects of
antibody, payload and linker technology need to be taken into consideration (Figure 3). Each part of the ADC needs
to meet high demands in order to provide high efficacy already by low drug doses, which in combination reduces the
potential for adverse reactions.
Figure 3: Schematic structure of IgG antibody drug conjugates. Figure adapted from Zolot et al. 2013 and Mulisch
2014.
Resulting from the antibody’s high selectivity, the minimal effective dose can be delivered to a target (e.g. cancer cell)
leading to low unspecific binding though providing the maximal tolerated dose (Schumacher et al. 2016).
The mode of action of ADCs is based on their degradation in cell’s lysosomes and subsequent payload release. To
achieve that, the antibody first needs to bind the antigen at the tumor cells surface. Receptor mediated endocytosis in
early endosomes imports the ADC into the cell. If the ADC’s Fc-domain binds to the FcRn-receptor of the endosome, it is
re-exported out of the cell. Thus, antibodies to be used as ADC should exhibit low or no binding to FcRn.
Late endosomes finally fuse with lysosomes leading to proteolytic degradation of the ADC. Depending on the selected
linker technology, the payload is released either by low pH or by proteolysis. The cytotoxic payload, usually DNA-
binding or microtubule polymerization inhibiting substances, leaves the lysosome and can access DNA or microtubules,
leading to immediate cell death or apoptosis initiation (Peters and Brown 2015).
Drawback of this ADC mode of action can be the so called “Bystander Effect”, where the released drug diffuses through
the cell membrane and affects neighboring healthy cells (Bouchard et al. 2014).
pre-peptide
(31 aa)
pro-peptide
(45 aa)
mature MTG
(331 aa)
DSDDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRK
QQMTEEQREWLSYGCVGVTWVNSGQYPTNRLAFASFDEDRFKNELKNGR
PRSGETRAEFEGRVAKESFDEEKGFQRAREVASVMNRALENAHDESAYL
DNLKKELANGNDALRNEDARSPFYSALRNTPSFKERNGGNHDPSRMKAV
IYSKHFWSGQDRSSSADKRKYGDPDAFRPAPGTGLVDMSRDRNIPRSPT
SPGEGFVNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESK
FRNWSEGYSDFDRGAYVITFIPKSWNTAPDKVKQGWP
MRIRRRALVFATMSAVLCTAGFMPSAGEAAA
DNGAGEETKSYAETYRLTADDVANINALNESAPAASSAGPSFRAP
Light Chain
Heavy Chain
Linker
• Stable in blood to minimize uncontrolled drug release
• Does not alter the antibody characteristics (pharmacokinetics)
• Ensures cytotoxic agent is functional at the target site
Payload
• Non-immunogenic
• Non-toxic during circulation in the blood
• Highly potent in small quantities
Antibody (IgG)
• Maintains characteristics when cross-linked to cytotoxic molecules via linker
• Targets a well characterized antigen found only on target cells
• Targets an antigen that is not downregulated on Ab binding
• Minimal non-specific binding
Fc
F(ab)
2
Fab
MTG: a versatile tool for site specific conjugation